DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and EIF3G2

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_196219.3 Gene:EIF3G2 / 830487 AraportID:AT5G06000 Length:308 Species:Arabidopsis thaliana


Alignment Length:203 Identity:46/203 - (22%)
Similarity:70/203 - (34%) Gaps:61/203 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FVQVSEEEGDEPIELPAEEDGTLLLSTLQAQFPGSCGLKYRNLDTKAVRGVRSNEGRLFPP---- 63
            |...:.||....:.:.:.||  ::|..::|  |||      |.:...|.|  .:..:|..|    
plant    82 FGDAAHEESSSYLTMRSTED--IILERIRA--PGS------NAEQSTVSG--DSMSQLGKPGAVL 134

  Fly    64 ------------------------------------SVESGWGEYAYFCVFPKENKRKSDDNLEN 92
                                                |..:|.|..||   .|...:..:|.....
plant   135 MVCRLCQKKGDHWTSRCPQKDLLSLMDEPLTAETSTSTITGTGRAAY---VPPSMREGADRKAGG 196

  Fly    93 STAKTKRIETRLRCTDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGS 157
            |..:::..|..:|.|:     |...|....|.|.|..:|.|....:..|.|:..|:|||||.|.|
plant   197 SDMRSRHDENSVRVTN-----LSEDTRGPDLMELFRPFGAVTRCHVAIDQKTSMSRGFGFVSFVS 256

  Fly   158 -YDAQMRV 164
             .|||..:
plant   257 REDAQRAI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833 20/114 (18%)
RRM1_TDP43 108..181 CDD:409760 20/58 (34%)
RRM2_TDP43 192..261 CDD:409761
EIF3G2NP_196219.3 eIF3g 32..157 CDD:463545 15/86 (17%)
RRM_eIF3G_like 207..282 CDD:409842 22/63 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.