DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and AT5G04600

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_196080.1 Gene:AT5G04600 / 830337 AraportID:AT5G04600 Length:222 Species:Arabidopsis thaliana


Alignment Length:85 Identity:24/85 - (28%)
Similarity:39/85 - (45%) Gaps:18/85 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 VFVGRCTEDINSDDLREYFSKFGEVTDVFIPR-----PFRAFSFVTFLDPDVAQSLCGE------ 247
            :::||........::..:||:||.|..|.:.|     ..:.|.|:.|.||:||:...|.      
plant    62 LYIGRIPHGFYETEIEAFFSQFGTVKRVRVARNKKTGKSKHFGFIQFEDPEVAEIAAGAMNDYLL 126

  Fly   248 -DHIIKGVSVHV---SNAAP 263
             :|::|   |||   .|..|
plant   127 MEHMLK---VHVIEPENVKP 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760
RRM2_TDP43 192..261 CDD:409761 22/81 (27%)
AT5G04600NP_196080.1 RRM_NIFK_like 61..134 CDD:409748 19/74 (26%)
PABP-1234 80..>204 CDD:130689 22/67 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.