DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and AT4G36960

DIOPT Version :9

Sequence 1:NP_001163280.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001154290.1 Gene:AT4G36960 / 829850 AraportID:AT4G36960 Length:379 Species:Arabidopsis thaliana


Alignment Length:169 Identity:54/169 - (31%)
Similarity:88/169 - (52%) Gaps:10/169 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNRHLIDG 173
            |:|||:||....:.|::|...:|::....:.||..:|:|:|||:|.|.|.:.....|...|.:..
plant     5 LVVLGIPWDIDSDGLKDYMSKFGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNALKGEHFLGN 69

  Fly   174 RWCEVKVPNSKGMGHQVPCK----VFVGRCTEDINSDDLREYFSKFGEVTDVFIPRPF-----RA 229
            |..||||...|....| |.|    :||.|....::..|.|.:|.::||:||:::|:.:     |.
plant    70 RILEVKVATPKEEMRQ-PAKKVTRIFVARIPSSVSESDFRSHFERYGEITDLYMPKDYNSKQHRG 133

  Fly   230 FSFVTFLDPDVAQSLCGEDHIIKGVSVHVSNAAPKAEQN 268
            ..|:||...|..:.|..:.|.:.|.:|.|..|.||.:.:
plant   134 IGFITFSSADSVEDLMEDTHDLGGTTVAVDRATPKEDDH 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_001163280.1 RRM1_TDP43 108..184 CDD:240767 26/74 (35%)
RRM2_TDP43 192..261 CDD:240768 22/77 (29%)
AT4G36960NP_001154290.1 RRM_SF 4..77 CDD:418427 25/71 (35%)
PABP-1234 5..>378 CDD:130689 54/169 (32%)
RRM_SF 91..166 CDD:418427 21/74 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1425837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.