DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and GRP4

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_189025.1 Gene:GRP4 / 821966 AraportID:AT3G23830 Length:136 Species:Arabidopsis thaliana


Alignment Length:72 Identity:26/72 - (36%)
Similarity:41/72 - (56%) Gaps:3/72 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 RLRCTDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTN 167
            |...:.|.|.||.|.|.:.||::.|.::|||..|.:..|.::|:|:|||||.|...|:....:..
plant    31 RYMSSKLFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAIKE 95

  Fly   168 RHLIDGR 174
               :||:
plant    96 ---MDGK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 25/67 (37%)
RRM2_TDP43 192..261 CDD:409761
GRP4NP_189025.1 PLN03134 1..122 CDD:178680 26/72 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.