DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and RBP47B

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_188544.1 Gene:RBP47B / 821447 AraportID:AT3G19130 Length:435 Species:Arabidopsis thaliana


Alignment Length:268 Identity:78/268 - (29%)
Similarity:110/268 - (41%) Gaps:64/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 STAKTKRIETRLRCTDLIVL--GLPWKTTEESLREYF-ETYGEVLMAQIKKDTKSGQSKGFGFVR 154
            ||.:.:.:|..   .||.|.  .|....|:..|.|.| :.|..|..|::..|:.:|:|||:||||
plant   189 STGEKRAVENG---PDLSVFVGDLSPDVTDVLLHETFSDRYPSVKSAKVVIDSNTGRSKGYGFVR 250

  Fly   155 FGSYDAQMRVLTNRHLIDGRWCE-------VKVP------------------------NSKGMGH 188
            ||..:.:.|.||.   ::|.:|.       :..|                        .|.|.|.
plant   251 FGDENERSRALTE---MNGAYCSNRQMRVGIATPKRAIANQQQHSSQAVILAGGHGSNGSMGYGS 312

  Fly   189 Q-----VPCKVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRPFRAFSFVTFLD----PDVAQSL 244
            |     ....:|||....|:..:|||:.||:||||..|.|| ..:...||.|.|    .|..:||
plant   313 QSDGESTNATIFVGGIDPDVIDEDLRQPFSQFGEVVSVKIP-VGKGCGFVQFADRKSAEDAIESL 376

  Fly   245 CGEDHIIKGVSVHVSNAAPKAEQNRNQQVQSYNYNSANSFGMHSYHPQGNHMNPGRNGHHRGNNQ 309
            .|.  :|...:|.:|......:|.|....|.:|...:..   |.|:..|.:.|     ||..||.
plant   377 NGT--VIGKNTVRLSWGRSPNKQWRGDSGQQWNGGYSRG---HGYNNGGGYAN-----HHDSNNY 431

  Fly   310 HNAHGGEN 317
            |    |||
plant   432 H----GEN 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 27/82 (33%)
RRM2_TDP43 192..261 CDD:409761 27/72 (38%)
RBP47BNP_188544.1 RRM1_SECp43_like 109..189 CDD:409780 78/268 (29%)
RRM2_SECp43_like 201..280 CDD:409781 27/81 (33%)
RRM_SF 320..391 CDD:473069 27/73 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.