DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and AT3G13224

DIOPT Version :9

Sequence 1:NP_001163280.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_683559.2 Gene:AT3G13224 / 820515 AraportID:AT3G13224 Length:358 Species:Arabidopsis thaliana


Alignment Length:348 Identity:99/348 - (28%)
Similarity:145/348 - (41%) Gaps:67/348 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RKSDDNLENSTAKTKRIETRLRCTDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSK 148
            |..:||.::....:.        ..:.:.||...||.....::|..|||:..:.|.:|..:||.:
plant     4 RSRNDNFQSGDGASP--------GKIFIGGLHKDTTNTVFNKHFGKYGEITDSVIMRDRHTGQPR 60

  Fly   149 GFGFVRFGSYDAQMRVLTNRHLIDGRWCEVK--VPNSKGMGHQ----VPCKVFVGRCTEDINSDD 207
            ||||:.|.......:|:.:.|:|:|:..|:|  :|...| |:|    ...|:|||.....:..|:
plant    61 GFGFITFADPSVVDKVIEDTHVINGKQVEIKRTIPKGAG-GNQSKDIKTKKIFVGGIPSTVTEDE 124

  Fly   208 LREYFSKFGEVTDVFIPRPF-----RAFSFVTFLDPDVAQSLCGEDHII--KGVSVHVSNAAPKA 265
            |:::|:|:|.|.:..:.|..     |.|.||.|...:|...|..:.::|  ....|.:..|.||.
plant   125 LKDFFAKYGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPKK 189

  Fly   266 EQNRNQQVQSYNYNSANSFGMHSYHPQGNHMNP------GRNGHHRGNNQH-----NAHGGENAI 319
            ..||          |..|:|.   ||:|...|.      |..|...|...|     .:|||    
plant   190 SLNR----------SPPSYGS---HPRGRSSNDSYASYGGPYGGFDGGYGHPPGPIRSHGG---- 237

  Fly   320 VPNNHNIGTAGYGMGGNNYGGNSGGGYHNNGGNHSSGGNTNRQDGGSQYNSR----QSNFHGMNQ 380
             |.:...|  |||.|..:.|...||||:|.||. |.||..|....|  |:||    .|.|.|...
plant   238 -PASRYAG--GYGYGRGSVGPEFGGGYNNYGGG-SLGGYRNEPPLG--YSSRFGPYGSGFGGEGY 296

  Fly   381 PHNGN-------VGGSNGWMNRG 396
            ...|.       .||..|:...|
plant   297 GRGGEGAYLGYPRGGGEGYGGYG 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_001163280.1 RRM1_TDP43 108..184 CDD:240767 24/77 (31%)
RRM2_TDP43 192..261 CDD:240768 20/75 (27%)
AT3G13224NP_683559.2 RRM_SF 21..91 CDD:418427 22/69 (32%)
RRM_SF 110..188 CDD:418427 21/77 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48033
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.