DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and AT3G08000

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_187457.1 Gene:AT3G08000 / 819991 AraportID:AT3G08000 Length:143 Species:Arabidopsis thaliana


Alignment Length:78 Identity:29/78 - (37%)
Similarity:42/78 - (53%) Gaps:13/78 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 CTD--------LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSY-DAQ 161
            ||.        |.:.||.|...|:||::.|.::|||...:|..|..||:|:|||||.|... || 
plant    32 CTSSSASPSSKLFIGGLSWSVDEQSLKDAFSSFGEVAEVRIAYDKGSGRSRGFGFVDFAEEGDA- 95

  Fly   162 MRVLTNRHLIDGR 174
               |:.:..:||:
plant    96 ---LSAKDAMDGK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 27/76 (36%)
RRM2_TDP43 192..261 CDD:409761
AT3G08000NP_187457.1 RRM 42..124 CDD:440488 27/68 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.