DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and AT2G37510

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001325085.1 Gene:AT2G37510 / 818327 AraportID:AT2G37510 Length:167 Species:Arabidopsis thaliana


Alignment Length:117 Identity:32/117 - (27%)
Similarity:50/117 - (42%) Gaps:29/117 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SDDNLENSTAKTKRIETRLRCTDLIVLGLPWKTTEESLREYFETYGEV----------------- 133
            |...|.:.:...:|..| |....|.|.||...||.|.|::.|.::|::                 
plant    14 SSSLLSSPSLCVRRCST-LTSPRLFVSGLSRLTTNEKLQDAFASFGQLVDGNVTLGFLNPIYIEH 77

  Fly   134 --------LMAQIKKDTKSGQSKGFGFVRFGSY-DAQ-MRVLTNRHLIDGRW 175
                    :.|::..|..||:|||||||.:.:. ||: .:...|...:|| |
plant    78 QINRFCFHVAARVITDRDSGRSKGFGFVTYATIEDAEKAKAEMNAKFLDG-W 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 27/95 (28%)
RRM2_TDP43 192..261 CDD:409761
AT2G37510NP_001325085.1 RRM 35..132 CDD:440488 27/95 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.