DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and TRA2B

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_004584.1 Gene:TRA2B / 6434 HGNCID:10781 Length:288 Species:Homo sapiens


Alignment Length:161 Identity:43/161 - (26%)
Similarity:69/161 - (42%) Gaps:32/161 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 FPKENKRKSDDNLENSTAKTKRIETRL----RCTDLIVLGLPWKTTEESLREYFETYGEVLMAQI 138
            :.::.:|:...:....:.:.:.:..|.    .|. |.|.||...|||..|||.|..||.:....|
Human    86 YSRDYRRRHSHSHSPMSTRRRHVGNRANPDPNCC-LGVFGLSLYTTERDLREVFSKYGPIADVSI 149

  Fly   139 KKDTKSGQSKGFGFVRFGSYD--AQMRVLTNRHLIDGRWCEV-----KVPNSKGMGHQVPCKVFV 196
            ..|.:|.:|:||.||.|.:.|  .:.:...|...:|||...|     |.|::...|      :::
Human   150 VYDQQSRRSRGFAFVYFENVDDAKEAKERANGMELDGRRIRVDFSITKRPHTPTPG------IYM 208

  Fly   197 GRCT-------------EDINSDDLREYFSK 214
            ||.|             .|...|| |:|:|:
Human   209 GRPTYGSSRRRDYYDRGYDRGYDD-RDYYSR 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833 43/161 (27%)
RRM1_TDP43 108..181 CDD:409760 29/79 (37%)
RRM2_TDP43 192..261 CDD:409761 9/36 (25%)
TRA2BNP_004584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..114 2/27 (7%)
RRM_TRA2 117..196 CDD:409798 29/79 (37%)
Linker 193..230 7/42 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 196..225 6/34 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..288
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.