Sequence 1: | NP_001163280.1 | Gene: | TBPH / 37781 | FlyBaseID: | FBgn0025790 | Length: | 531 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001119193.1 | Gene: | AT5G08695 / 6241377 | AraportID: | AT5G08695 | Length: | 690 | Species: | Arabidopsis thaliana |
Alignment Length: | 240 | Identity: | 54/240 - (22%) |
---|---|---|---|
Similarity: | 86/240 - (35%) | Gaps: | 77/240 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 80 KENKRKSDDNLENSTAKTKRIETRL--RC-TDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKD 141
Fly 142 TKSGQSKGFGFVRFGSYDAQMRVLTNRHLIDGRWCEVKVPNSKGM---GHQVPCKVFVGRCTEDI 203
Fly 204 NSDDLREYFSKFGEVTDVFI-----PRPFRAFSFVTFLDPDVAQSLCGE-DHI-IKGVSVHVSNA 261
Fly 262 APKA--------------------EQNRNQQVQSYNYNSANSFGM 286 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
TBPH | NP_001163280.1 | RRM1_TDP43 | 108..184 | CDD:240767 | 12/75 (16%) |
RRM2_TDP43 | 192..261 | CDD:240768 | 20/75 (27%) | ||
AT5G08695 | NP_001119193.1 | RRM1_MRD1 | 4..79 | CDD:241009 | |
ELAV_HUD_SF | 6..300 | CDD:273741 | 42/190 (22%) | ||
RRM3_RBM19_RRM2_MRD1 | 228..301 | CDD:240762 | 20/72 (28%) | ||
ELAV_HUD_SF | 229..618 | CDD:273741 | 31/120 (26%) | ||
RRM4_RBM19_RRM3_MRD1 | 421..492 | CDD:240763 | |||
RRM_SF | 536..615 | CDD:302621 | |||
RRM_SF | 635..>661 | CDD:302621 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR48033 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |