DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and RBM4

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_002887.2 Gene:RBM4 / 5936 HGNCID:9901 Length:364 Species:Homo sapiens


Alignment Length:196 Identity:47/196 - (23%)
Similarity:77/196 - (39%) Gaps:30/196 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNRHLIDG 173
            |.:..||.:.||:.:|..||.||:||...|        .|.:|||......|....:.|.|....
Human     4 LFIGNLPREATEQEIRSLFEQYGKVLECDI--------IKNYGFVHIEDKTAAEDAIRNLHHYKL 60

  Fly   174 RWCEVKVPNSKGMGHQVPCKVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRPFRAFSFVTFLDP 238
            ....:.|..||... :...|:.||..:....:.:||..|.::|.|.:..|.:.: ||..:...: 
Human    61 HGVNINVE
ASKNKS-KTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDY-AFVHMERAE- 122

  Fly   239 DVAQSLCGEDHI-IKGVSVHVSNAAPKAEQNRNQQVQSYNYNSANSFGMHSYHPQGNHMNPGRNG 302
            |..:::.|.|:. .:|..:||             |:.:....:|...|     .|......|:.|
Human   123 DAVEAIRGLDNTEFQGKRMHV-------------QLSTSRLRTAPGMG-----DQSGCYRCGKEG 169

  Fly   303 H 303
            |
Human   170 H 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 20/71 (28%)
RRM2_TDP43 192..261 CDD:409761 17/69 (25%)
RBM4NP_002887.2 RRM1_RBM4 2..68 CDD:410018 20/71 (28%)
RRM2_RBM4 78..144 CDD:410019 17/80 (21%)
PTZ00368 <145..>181 CDD:173561 6/31 (19%)
ZnF_C2HC 161..176 CDD:197667 3/10 (30%)
Interaction with TNPO3. /evidence=ECO:0000269|PubMed:12628928 196..364
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.