DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and CstF64

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster


Alignment Length:95 Identity:28/95 - (29%)
Similarity:45/95 - (47%) Gaps:19/95 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVL--TNRHLI 171
            :.|..:|::.|||.|:|.|...|.||..::..|.:||:.|||||..:...:..:..:  .|.:.|
  Fly    18 VFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEI 82

  Fly   172 DGRWCEVKVPNSKGMGHQVPCKVFVGRCTE 201
            .||  .::|.|:               |||
  Fly    83 GGR--TLRVDNA---------------CTE 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 23/73 (32%)
RRM2_TDP43 192..261 CDD:409761 3/10 (30%)
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 25/92 (27%)
CSTF2_hinge 111..190 CDD:433869
CSTF_C 377..416 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.