DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and CG5213

DIOPT Version :9

Sequence 1:NP_001163280.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster


Alignment Length:217 Identity:55/217 - (25%)
Similarity:96/217 - (44%) Gaps:28/217 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 TDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNRHLI 171
            |:||:..||...||..|...|..:||:..|:|.:..::|.|..:|||.:.| :.|.....|.  :
  Fly    41 TNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVS-ERQAAAAVNG--M 102

  Fly   172 DG---RWCEVKVPNSKGMGHQ-VPCKVFVGRCTEDINSDDLREYFSKFGEVTDVFIPR-----PF 227
            ||   |...:||..::...:: ....::||.....::...:||.|:.:|.:.||.:.|     ..
  Fly   103 DGYETRGKRLKVAFARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRS 167

  Fly   228 RAFSFVTF---LDPDVAQSLCGED-HIIKGVSVHVSNAAPKAEQNRNQQVQSYNYNSANSFGMHS 288
            |..:|:.|   .|.:||:  .|.| ::|:|.|..::....:.|:..         :|:.|.| ..
  Fly   168 RGVAFLQFELVRDAEVAK--YGMDRYMIEGASRPLTVKFVEREKKG---------SSSTSSG-SQ 220

  Fly   289 YHPQGNHMNPGRNGHHRGNNQH 310
            |..:.....|......|.|:.|
  Fly   221 YKDKRKSSPPPYKRRERTNDHH 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_001163280.1 RRM1_TDP43 108..184 CDD:240767 25/78 (32%)
RRM2_TDP43 192..261 CDD:240768 20/77 (26%)
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 26/78 (33%)
RRM 128..202 CDD:214636 20/75 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439581
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.