Sequence 1: | NP_001163280.1 | Gene: | TBPH / 37781 | FlyBaseID: | FBgn0025790 | Length: | 531 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097631.1 | Gene: | Rbp6 / 39919 | FlyBaseID: | FBgn0260943 | Length: | 499 | Species: | Drosophila melanogaster |
Alignment Length: | 271 | Identity: | 67/271 - (24%) |
---|---|---|---|
Similarity: | 104/271 - (38%) | Gaps: | 72/271 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLT-NRHLID 172
Fly 173 GRWCEVKVPNSKGMGHQVPC---KVFVGRCTEDINSDDLREYFSKFGEVTDVFI-----PRPFRA 229
Fly 230 FSFVTFLDPDVAQSLCG-EDHIIKGVSVHVSNAAPK----------------------------- 264
Fly 265 ----------------------------AEQNRNQQVQSYNYNSANSFGMHSYHPQGNHMNPGR- 300
Fly 301 NGHHRGNNQHN 311 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
TBPH | NP_001163280.1 | RRM1_TDP43 | 108..184 | CDD:240767 | 30/75 (40%) |
RRM2_TDP43 | 192..261 | CDD:240768 | 22/77 (29%) | ||
Rbp6 | NP_001097631.1 | RRM1_MSI | 31..105 | CDD:241020 | 30/73 (41%) |
RRM2_MSI | 119..192 | CDD:240769 | 22/72 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |