DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and hfp

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_525123.2 Gene:hfp / 38173 FlyBaseID:FBgn0028577 Length:637 Species:Drosophila melanogaster


Alignment Length:154 Identity:30/154 - (19%)
Similarity:61/154 - (39%) Gaps:12/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VFPKENKRKSDDNLENSTAKTKRIETRLRCTDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKD 141
            |..|:........|.....:.:|.:.......:.|..:.::..|:::|..|..:|.:....:..|
  Fly   100 VLMKQTLAHQQQQLATQRTQVQRQQALALMCRVYVGSISFELKEDTIRVAFTPFGPIKSINMSWD 164

  Fly   142 TKSGQSKGFGFVRFGSYDAQMRVL--TNRHLIDGRWCEVKVPNSKGMGHQVP----------CKV 194
            ..:.:.|||.||.:...:.....|  .|..|:.||..:|..|::.....||.          .::
  Fly   165 PITQKHKGFAFVEYEIPEGAQLALEQMNGALMGGRNIKVGRPSNMPQAQQVIDEVQEEAKSFNRI 229

  Fly   195 FVGRCTEDINSDDLREYFSKFGEV 218
            :|.....|::.:|::..|..||.:
  Fly   230 YVASIHPDLSEEDIKSVFEAFGPI 253

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity