DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and CG12288

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_609822.1 Gene:CG12288 / 35027 FlyBaseID:FBgn0032620 Length:435 Species:Drosophila melanogaster


Alignment Length:225 Identity:53/225 - (23%)
Similarity:82/225 - (36%) Gaps:69/225 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EEEGDEPIELPAEEDGTLLLSTLQAQFPGSCGLKYRNLDTKAVRGVRSNEGRLFPP-------SV 65
            :|||.:.|..||||..|:.:..|.             ::||.|:.|     :||.|       .:
  Fly   140 DEEGVKRIRNPAEEASTVFVGNLP-------------INTKRVQLV-----KLFQPYGLVQSIRL 186

  Fly    66 ESGWGEYAYFCVFPKENKRKSDDNL------------------------EN-------------S 93
            .:..|:..:     |..:||...:|                        ||             .
  Fly   187 RTAGGKQLF-----KHKQRKVAGSLNAYVVLEKPEIAQQALALNGSEFKENHLRVTPASMAEKFG 246

  Fly    94 TAKTKRIETRLRCTDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSY 158
            .||.|:...:.....:.|..|.:..|||.|||.|.:.||:...:..:|...| .||..:|.|...
  Fly   247 QAKDKQPSDKDAKRTIFVGSLKYSATEEQLREIFSSCGEIDYIRCLQDGDKG-CKGVAYVCFQKP 310

  Fly   159 DA-QMRVLTNRHLIDGRWCEVKVPNSKGMG 187
            || .:.:..|:.|:|.|...|:....|.:|
  Fly   311 DAVGLALELNQTLLDDRPINVERYQVKKLG 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833 18/76 (24%)
RRM1_TDP43 108..181 CDD:409760 24/73 (33%)
RRM2_TDP43 192..261 CDD:409761
CG12288NP_609822.1 RRM1_RBM34 156..237 CDD:409828 16/103 (16%)
RRM_SF 261..332 CDD:473069 23/71 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.