DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and Ref2

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_609574.1 Gene:Ref2 / 34667 FlyBaseID:FBgn0032439 Length:220 Species:Drosophila melanogaster


Alignment Length:184 Identity:43/184 - (23%)
Similarity:72/184 - (39%) Gaps:43/184 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 KRKSDDNL------ENSTA---KTK-RIETRL----RCTDLIVLGLPWKTTEESLREYFETYGEV 133
            ||.|:..|      .|.|.   |:| :.||.|    :.|.::|..|.:...::.:.|.|...|.|
  Fly    37 KRNSEGGLRGIQRSRNGTGFIRKSKFKQETLLKPPKKPTLVMVCNLDYGVDDDDIMELFNQDGVV 101

  Fly   134 LMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNRH--LIDGRWCEVK-VPNSKG---------- 185
            ....:..| :.|.|.|...:.|...:...:::...|  .:|||..::. |.|::.          
  Fly   102 EKGFVHYD-RDGNSLGTAHLSFKYREEAFQIIEQFHGVRLDGRRLKLHLVQNTRNFKRTDVDDLS 165

  Fly   186 --MGHQVPCKVFVGRCTED--INSDDLREYFSK---FGEVTDVFIPRPFRAFSF 232
              ||.      |..|..::  ..:..|:..|.|   |...:  |.||||:..:|
  Fly   166 LRMGS------FKTRFLQNGTFKTRSLQNGFQKSRLFRNSS--FKPRPFKKHNF 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 15/75 (20%)
RRM2_TDP43 192..261 CDD:409761 12/46 (26%)
Ref2NP_609574.1 RRM_SF 75..149 CDD:473069 16/74 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.