DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and Hrb27C

DIOPT Version :9

Sequence 1:NP_001163280.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001162897.1 Gene:Hrb27C / 33968 FlyBaseID:FBgn0004838 Length:421 Species:Drosophila melanogaster


Alignment Length:469 Identity:125/469 - (26%)
Similarity:182/469 - (38%) Gaps:126/469 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTN-RHLID 172
            |.|.||.|:||:|:|..||..:|:::...:.|:.:||:|:|||||.|........||.| .|.:|
  Fly     9 LFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTLD 73

  Fly   173 GRWCEVKVPN-------SKGMGHQVPCKVFVGRCTEDINSDDLREYFSKFGEVTDVFI-----PR 225
            ||..:.|..|       .||.|:    |||:|....::...|||.:|:::|:||:|.|     .:
  Fly    74 GRTIDPKPCNPRTLQK
PKKGGGY----KVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKK 134

  Fly   226 PFRAFSFVTFLDPDVAQSLCGEDHI-IKGVSVHVSNAAPKAEQNRNQQVQSYNYNSANSFGMHSY 289
            ..|.|.|::|.:....:.:..|.:| :.|..|.:..|.|:.        .|...||.||....:|
  Fly   135 KSRGFGFLSFEEESSVEHVTNERYINLNGKQVEIKKAEPRD--------GSGGQNSNNSTVGGAY 191

  Fly   290 HPQGN---HMNPGRNGHHRGNNQHNAHGGENAIVPNNHNIGT----AGY-GMGGN----NYG-GN 341
            ...||   |..|    ||...|......|:....|.|..||.    .|| |.|.:    .|| ||
  Fly   192 GKLGNECSHWGP----HHAPINMMQGQNGQMGGPPLNMPIGAPNMMPGYQGWGTSPQQQQYGYGN 252

  Fly   342 SGGGYHNNGG-------------NHSSGGNTNRQDGGSQYNSRQSNFHGMNQPHNGNVGGS-NGW 392
            ||.|.:...|             |::....|....|...|||..:     ..|...:.||| |.|
  Fly   253 SGPGSYQGWGAPPGPQGPPPQWSNYAGPQQTQGYGGYDMYNSTST-----GAPSGPSGGGSWNSW 312

  Fly   393 MNRGHLDMPNLQALGINSQGSSSSNQGQNMSNQSMLNLNSLPINPALVAAALNQWSLVGNQLQNQ 457
                  :||.      ||.|.:.:                    |...|         |......
  Fly   313 ------NMPP------NSAGPTGA--------------------PGAGA---------GTATDMY 336

  Fly   458 NQDQQGGNFLSWMAQNGGHNNANNFGG--RKGPNNPNNNPAANGIKTDNSEPQNG---------- 510
            ::.|      :|  ..||.:.....||  |.|   |.|:.:.:|.:.|.....:|          
  Fly   337 SRAQ------AW--ATGGPSTTGPVGGMPRTG---PGNSASKSGSEYDYGGYGSGYDYDYSNYVK 390

  Fly   511 NTGWSNQSSGSQNA 524
            ..|.||..:|.::|
  Fly   391 QEGASNYGAGPRSA 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_001163280.1 RRM1_TDP43 108..184 CDD:240767 31/82 (38%)
RRM2_TDP43 192..261 CDD:240768 21/74 (28%)
Hrb27CNP_001162897.1 RRM1_DAZAP1 8..89 CDD:241018 31/79 (39%)
RRM2_DAZAP1 94..173 CDD:240773 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.