DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and rbm7

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_956219.1 Gene:rbm7 / 334784 ZFINID:ZDB-GENE-030131-6724 Length:252 Species:Danio rerio


Alignment Length:303 Identity:70/303 - (23%)
Similarity:103/303 - (33%) Gaps:100/303 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRV---LTNRHL 170
            |.|..|..:.|||.:.|.|...|.::..:|.|:.: |:||.|.||.| .::..:..   |.|...
Zfish    11 LFVGNLDPQVTEEVIFELFLQAGPLIKVKIPKNNE-GKSKLFAFVNF-KHEVSVPYALNLLNGIR 73

  Fly   171 IDGRWCEVKVP------NSKGM--------------GHQVPCKVFVGRCTEDINSDDLREYFSKF 215
            :.||...:|..      |.:|.              ||:      .||..|.:.|..        
Zfish    74 LHGRQLNIKFKTGSSHINQEGKSPANSQNPSPANTPGHR------GGRTPEQMGSPS-------- 124

  Fly   216 GEVTDVFIP-----RPFRAFSFVTFLDPDVAQSLCGEDHIIKGVSVHVSNAAPKAEQNRNQQVQS 275
                  :.|     |||.:        ||..|.                    :|..|...|||.
Zfish   125 ------YSPPQHMQRPFSS--------PDTLQR--------------------QAMMNNMWQVQM 155

  Fly   276 YNYNS-ANSFGMHSYHPQGNHMNPGRNGH--HRGNNQHNAHGGENAIVPNNHNIGTAGYGMGGNN 337
            ..... :.:|......|:|| .:.|.:||  .|.:.|.|          |||......:|.|.||
Zfish   156 QQLQMLSGTFQQGMQQPRGN-ADGGWSGHRGQRHSPQDN----------NNHQGRDQRHGNGANN 209

  Fly   338 Y-----GGNSGGGYHNNGGNHSSGGNTNRQDGGSQYNSRQSNF 375
            |     .|..|..||:   :..|||:........:.:||:..:
Zfish   210 YERNRRDGQRGDFYHH---DDRSGGHNRNYPPDRRRDSREGRW 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 23/74 (31%)
RRM2_TDP43 192..261 CDD:409761 11/73 (15%)
rbm7NP_956219.1 RRM_RBM7 8..82 CDD:410005 22/72 (31%)
PABP-1234 <11..195 CDD:130689 53/244 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..137 12/68 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..252 26/93 (28%)
PRK12678 <171..>248 CDD:237171 26/90 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.