DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and fne

DIOPT Version :9

Sequence 1:NP_001163280.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster


Alignment Length:294 Identity:65/294 - (22%)
Similarity:108/294 - (36%) Gaps:93/294 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 NSTAKTKRIETRLRCTDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKS------------ 144
            |.:......|:|   |:|||..||...|:|.:|..|.:.||:...::.:|..|            
  Fly    14 NGSVDGSNDESR---TNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTAL 75

  Fly   145 ------GQSKGFGFVRF-GSYDAQMRVLTNRHLIDGRWCEVKV-------PNS---KGMGHQVPC 192
                  |||.|:|||.: .:.||:..|.|    ::|...:.||       |:|   ||      .
  Fly    76 NPALQQGQSLGYGFVNYVRAEDAEKAVNT----LNGLRLQNKVIKVSYARPSSESIKG------A 130

  Fly   193 KVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRPFRAFSFVTFLDPDVAQSLCGEDHIIKGVSVH 257
            .::|....::::..||...|:.||::.                    .::.||..   |.|:|..
  Fly   131 NLYVSGLPKNLSQPDLEGMFASFGKII--------------------TSRILCDN---ISGLSKG 172

  Fly   258 VS-------NAAPKAEQNRNQQVQ---------SYNYNSANSFGMHSYHPQGNHMNPGRNGHHR- 305
            |.       |.|.:|.|..|.:..         .:..|.:||.......|...::.|......| 
  Fly   173 VGFIRFDQRNEAERAIQELNGKTPKGYAEPITVKFANNPSNSAKAQIAPPLTAYLTPQAAAATRR 237

  Fly   306 --------GNNQHNAHGGE---NAIVPNNHNIGT 328
                    |..:::...|:   |:|:|.|...|:
  Fly   238 LAGALPSAGRIRYSPLAGDLLANSILPGNAMTGS 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_001163280.1 RRM1_TDP43 108..184 CDD:240767 29/104 (28%)
RRM2_TDP43 192..261 CDD:240768 12/75 (16%)
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 64/285 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439642
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.