DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and Spx

DIOPT Version :9

Sequence 1:NP_001163280.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster


Alignment Length:202 Identity:48/202 - (23%)
Similarity:77/202 - (38%) Gaps:36/202 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRF-GSYDAQMRV-LTNRHLIDGRW 175
            ||..|.:|..|.|.|...|.|:...:.||..:...:|:|||.| ...||...: :.|...:.|:.
  Fly    19 GLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGIKIMNMIKLYGKP 83

  Fly   176 CEVKVPNSKGMGHQ----VPCKVFVGRCTEDINSDDLREYFSKFGEVTDVFIPRPFR-------- 228
            ..|    :|...||    |...:|:|....:::...|.:.||.||.:...  |:..|        
  Fly    84 IRV----NK
ASAHQKNLDVGANIFIGNLDVEVDEKLLYDTFSAFGVILQT--PKIMRDPETGKSK 142

  Fly   229 AFSFVTF---------LDPDVAQSLCGEDHIIKGVSVHVSNAAPKAEQNRNQQVQSYNYNSANSF 284
            :|:|:.|         :|....|.||..       .:.||.|..|..:.......:....:|.:.
  Fly   143 SFAFINFASFEASDAAMDAMNGQYLCNR-------PISVSYAFKKDHKGERHGSAAERLLAAQNP 200

  Fly   285 GMHSYHP 291
            ..|:..|
  Fly   201 STHADRP 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_001163280.1 RRM1_TDP43 108..184 CDD:240767 21/72 (29%)
RRM2_TDP43 192..261 CDD:240768 18/85 (21%)
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 21/72 (29%)
RRM2_SF3B4 99..181 CDD:240781 19/90 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439630
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.