DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and ssx

DIOPT Version :9

Sequence 1:NP_001163280.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster


Alignment Length:402 Identity:96/402 - (23%)
Similarity:143/402 - (35%) Gaps:136/402 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 ENKRKSDDN--LENSTAKTKRIE--TRLRCTDLIVLGLPWKTTEESLREYFETYGEVLMAQIKKD 141
            |.:..|.||  .:||..:.::::  .|...|:||:..||...|:..|...|...|.:...:|.:|
  Fly    63 EEQHHSQDNEGNDNSAGQQQQMQQVDRTSATNLIINYLPQDMTDRELYNLFSGCGPINTCKIMRD 127

  Fly   142 TKSGQSKGFGFVRF----GSYDAQMRV----LTNRHLIDGRWCEVKVPNSKGMGHQV-PCKVFVG 197
            .|:|.|.|:|||.:    .|.||..::    :.|:.|        ||..::..|..: ...::|.
  Fly   128 FKTGYSFGYGFVDYKTESDSEDAIQKLNGFYVRNKRL--------KVSYARPGGQSIKDTNLYVI 184

  Fly   198 RCTEDINSDDLREYFSKFGEVT------DVFIPRPFRAFSFVTFLDPDVAQSLCGEDHIIKGVSV 256
            ..:.:||.|.|...||.:|.:.      |....|| |..:||.:...:.||      ..||.   
  Fly   185 NLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRP-RGVAFVRYNKREEAQ------EAIKA--- 239

  Fly   257 HVSNAAPK----------AEQNRNQQVQSY-------------------------------NYNS 280
             ::|..|:          ||::...:...:                               |::.
  Fly   240 -LNNTVPEGGSQPIWVRLAEEHGKAKAAQFMAQIGGGNGGGGGGPPHMGPGGPMHPPHHHNNHHH 303

  Fly   281 ANSFGMH---------------SYHPQ---------GNHMNPGRNGHHRGNNQHNAH--GGEN-- 317
            .|....|               .:|||         .||.|...|.||..||.:|.|  ||.:  
  Fly   304 NNHHNPHMPPHHHQPQHPHQHPQHHPQLHHMQHHHPNNHNNNHPNNHHHNNNNNNHHNMGGPHPH 368

  Fly   318 ---AIVPNNHNIGTA-----GYGMGGNNYGGNSGGGYHNNGGNHSSGGNTNRQDGGSQYNSRQSN 374
               .:.|...|:|..     |.|||...:||..|||    ||....||               .|
  Fly   369 HMQQMHPMGMNMGMGVNMGMGMGMGMPIHGGGGGGG----GGGGGGGG---------------GN 414

  Fly   375 FHGMNQPHNGNV 386
            ||.|  .|.|.|
  Fly   415 FHHM--AHRGEV 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_001163280.1 RRM1_TDP43 108..184 CDD:240767 24/83 (29%)
RRM2_TDP43 192..261 CDD:240768 18/74 (24%)
ssxNP_569908.1 RRM_SF 93..173 CDD:302621 25/87 (29%)
RRM_SF 179..257 CDD:302621 20/88 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.