DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and Rbm34

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_001014037.1 Gene:Rbm34 / 307956 RGDID:1310161 Length:428 Species:Rattus norvegicus


Alignment Length:245 Identity:56/245 - (22%)
Similarity:100/245 - (40%) Gaps:65/245 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFVQVSEEEGDEPIELP-------AEEDGTLLLSTLQAQFPGSCGLK--------YRNLDTKAV 50
            :|......|:|.:..::|       .:.:.|:.:..|    |.:|..|        |..:::...
  Rat   154 LDVALSLNEDGRQRTKVPLNPEEERLKNERTVFVGNL----PVTCNKKKLKSFFKEYGQVESVRF 214

  Fly    51 RGVRSNEG----------RLFPPSVESGWGEYAYFCVFPKENKRKSDDNLENSTAKTK---RI-- 100
            |.|...||          |.|.|..:|    ...:.||.:|  |.:...|:.:.|:..   ||  
  Rat   215 RSVMPAEGTLSKKLAAIKRKFHPDQKS----INAYVVFKEE--RAAAKALQRNGAQIAEGFRIRV 273

  Fly   101 ----ETRLRCTDLIVLG-LPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDA 160
                ||..|....:.:| ||::..|.:|.|:|...|.::..:|.::..:|..:|||:|.|.:.||
  Rat   274 DLASETASRDKRSVFVGNLPYRVDESALEEHFLDCGSIVAVRIVRNPLTGVGRGFGYVLFENTDA 338

  Fly   161 QMRVLTNRHLIDGRWCEVKVPNSKGMGHQVPCKVFVGRCTEDINSDDLRE 210
            .       ||      .:|:.||:.||.::       |....:|.:.|::
  Rat   339 V-------HL------ALKLNNSELMGRKL-------RVMRSVNKEKLKQ 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833 17/99 (17%)
RRM1_TDP43 108..181 CDD:409760 20/73 (27%)
RRM2_TDP43 192..261 CDD:409761 3/19 (16%)
Rbm34NP_001014037.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..106
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..152
RRM1_RBM34 183..274 CDD:409828 22/100 (22%)
RRM2_RBM34 286..358 CDD:409829 25/91 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 361..428 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.