DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and TRA2A

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_037425.1 Gene:TRA2A / 29896 HGNCID:16645 Length:282 Species:Homo sapiens


Alignment Length:129 Identity:40/129 - (31%)
Similarity:57/129 - (44%) Gaps:11/129 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PKENKRKSDDNLENSTAKTKRIETRLRC-----TDLIVLGLPWKTTEESLREYFETYGEVLMAQI 138
            |:..:|:|   ..:|....:|..|..|.     |.|.|.||...|||..|||.|..||.:....:
Human    89 PEYRRRRS---RSHSPMSNRRRHTGSRANPDPNTCLGVFGLSLYTTERDLREVFSRYGPLSGVNV 150

  Fly   139 KKDTKSGQSKGFGFVRFGSYDAQMRVL--TNRHLIDGRWCEVKVPNSKGMGHQVPCKVFVGRCT 200
            ..|.::|:|:||.||.|...|.....:  .|...:|||...|....:| ..|.....:::||.|
Human   151 VYDQRTGRSRGFAFVYFERIDDSKEAMERANGMELDGRRIRVDYSITK-RAHTPTPGIYMGRPT 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 27/74 (36%)
RRM2_TDP43 192..261 CDD:409761 3/9 (33%)
TRA2ANP_037425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..118 7/31 (23%)
RRM_TRA2 118..197 CDD:409798 28/78 (36%)
Linker 198..225 5/17 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..245 4/13 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..282
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.