DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and hrb1

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_594207.3 Gene:hrb1 / 2542567 PomBaseID:SPAC328.05 Length:464 Species:Schizosaccharomyces pombe


Alignment Length:51 Identity:22/51 - (43%)
Similarity:34/51 - (66%) Gaps:2/51 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 CTDLIVLG-LPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRF 155
            |:|.|.:| |||.|::.:|.:.|...|.|:.|:|..: .:|:|||||.|:|
pombe   308 CSDCIYVGNLPWATSDRNLLDLFTDIGSVIRARIAYE-PTGRSKGFGVVQF 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 21/49 (43%)
RRM2_TDP43 192..261 CDD:409761
hrb1NP_594207.3 PABP-1234 62..>385 CDD:130689 22/51 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.