| Sequence 1: | NP_477400.1 | Gene: | TBPH / 37781 | FlyBaseID: | FBgn0025790 | Length: | 531 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_594207.3 | Gene: | hrb1 / 2542567 | PomBaseID: | SPAC328.05 | Length: | 464 | Species: | Schizosaccharomyces pombe |
| Alignment Length: | 51 | Identity: | 22/51 - (43%) |
|---|---|---|---|
| Similarity: | 34/51 - (66%) | Gaps: | 2/51 - (3%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 106 CTDLIVLG-LPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRF 155 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| TBPH | NP_477400.1 | TDP43_N | 3..78 | CDD:465833 | |
| RRM1_TDP43 | 108..181 | CDD:409760 | 21/49 (43%) | ||
| RRM2_TDP43 | 192..261 | CDD:409761 | |||
| hrb1 | NP_594207.3 | PABP-1234 | 62..>385 | CDD:130689 | 22/51 (43%) |
| Blue background indicates that the domain is not in the aligned region. | |||||