DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TBPH and rbm8

DIOPT Version :10

Sequence 1:NP_477400.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster
Sequence 2:NP_594439.1 Gene:rbm8 / 2541998 PomBaseID:SPAC23A1.09 Length:121 Species:Schizosaccharomyces pombe


Alignment Length:62 Identity:14/62 - (22%)
Similarity:32/62 - (51%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LIVLGLPWKTTEESLREYFETYGEVLMAQIKKDTKSGQSKGFGFVRFGSYDAQMRVLTNRHL 170
            :||.|:..:.|||.:.:.|..:|.|....:..|.::|..||:..:.:.:.:...:.:..::|
pombe    12 IIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRTGYVKGYALIEYATLEQAQKAVDEKNL 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TBPHNP_477400.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760 14/62 (23%)
RRM2_TDP43 192..261 CDD:409761
rbm8NP_594439.1 RRM_RBM8 4..90 CDD:409762 14/62 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.