DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pym and PYM1

DIOPT Version :9

Sequence 1:NP_726372.1 Gene:Pym / 37780 FlyBaseID:FBgn0034918 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_115721.1 Gene:PYM1 / 84305 HGNCID:30258 Length:204 Species:Homo sapiens


Alignment Length:215 Identity:72/215 - (33%)
Similarity:118/215 - (54%) Gaps:48/215 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GKFIPATKRPDGTWRKARRVKDGYVPQEEVPLYESKGKQFVAQRQAGVPPGMCPLLAAESKKERE 74
            ||:|.:|:||||||||.||||:|||||||||:||:|..:|...:.. :|||:.|...|.....| 
Human    13 GKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPE-LPPGLSPEATAPVTPSR- 75

  Fly    75 KQERTRAKKQEKESGRQPKAPAPGVLVMPPSTCPPPKVSQQQQQQQQQPSG-----SRDINSISK 134
                             |:...||:     |......:.::::::|||..|     ||.::.:| 
Human    76 -----------------PEGGEPGL-----SKTAKRNLKRKEKRRQQQEKGEAEALSRTLDKVS- 117

  Fly   135 TLEDTLKLDAAQE-----------------VVDPAKQLKKLRKKIREIEQIESRIQAGEQKKLDK 182
             ||:|.:|.:|.:                 ..:.||::|.|:||:|::|:::.||||||..:..|
Human   118 -LEETAQLPSAPQGSRAAPTAASDQPDSAATTEKAKKIKNLKKKLRQVEELQQRIQAGEVSQPSK 181

  Fly   183 DQLDKVKKKSEILRQIKDLE 202
            :||:|:.::..:..:::|||
Human   182 EQLEKLARRRALEEELEDLE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PymNP_726372.1 Mago-bind 11..35 CDD:286378 17/23 (74%)
PYM1NP_115721.1 Required for interaction with MAGOH and RBM8A 1..33 14/19 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32 13/18 (72%)
Mago-bind 14..38 CDD:312698 17/23 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..151 22/121 (18%)
eIF2A-like 152..204 20/50 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11946
eggNOG 1 0.900 - - E1_KOG4325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I4773
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59719
OrthoDB 1 1.010 - - D1545729at2759
OrthoFinder 1 1.000 - - FOG0004103
OrthoInspector 1 1.000 - - oto90397
orthoMCL 1 0.900 - - OOG6_105546
Panther 1 1.100 - - LDO PTHR22959
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3921
SonicParanoid 1 1.000 - - X3373
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.