DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pym and Pym1

DIOPT Version :9

Sequence 1:NP_726372.1 Gene:Pym / 37780 FlyBaseID:FBgn0034918 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_030101251.1 Gene:Pym1 / 78428 MGIID:1925678 Length:243 Species:Mus musculus


Alignment Length:210 Identity:71/210 - (33%)
Similarity:117/210 - (55%) Gaps:39/210 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GKFIPATKRPDGTWRKARRVKDGYVPQEEVPLYESKGKQFVAQRQAGVPPGMCPLLAAESKKERE 74
            ||:|.:|:||||||||.||||:|||||||||:||:|..:|...:.. :|||:.|.........|.
Mouse    53 GKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPE-LPPGLSPEATTPVTPSRP 116

  Fly    75 KQERTRAKKQEKESGRQPKAPAPGVLVMPPSTCPPPKVSQQQQQQQQQPSGSRDINSISKTLEDT 139
            :...|...|..|.:.::                   |..::|||:::..:.||.::.:|  |.||
Mouse   117 EGGETGLSKTAKRNLKR-------------------KEKRRQQQEKEAEALSRTLDKVS--LGDT 160

  Fly   140 LKLDAAQE--------VVDP---------AKQLKKLRKKIREIEQIESRIQAGEQKKLDKDQLDK 187
            .::.:|.:        ..||         ||::|.||||:|::|:::.||||||..:..::||:|
Mouse   161 AQIPSALQGPQATPLAASDPSDSAATTEKAKKIKNLRKKLRQVEELQQRIQAGEVSQPSREQLEK 225

  Fly   188 VKKKSEILRQIKDLE 202
            :.::..:..:::|||
Mouse   226 LARRRVLEEELEDLE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PymNP_726372.1 Mago-bind 11..35 CDD:286378 17/23 (74%)
Pym1XP_030101251.1 Mago-bind 54..78 CDD:370406 17/23 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849663
Domainoid 1 1.000 72 1.000 Domainoid score I9326
eggNOG 1 0.900 - - E1_KOG4325
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4784
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59719
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004103
OrthoInspector 1 1.000 - - oto93981
orthoMCL 1 0.900 - - OOG6_105546
Panther 1 1.100 - - LDO PTHR22959
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3921
SonicParanoid 1 1.000 - - X3373
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.