DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pym and pym1

DIOPT Version :9

Sequence 1:NP_726372.1 Gene:Pym / 37780 FlyBaseID:FBgn0034918 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001016274.1 Gene:pym1 / 549028 XenbaseID:XB-GENE-943122 Length:200 Species:Xenopus tropicalis


Alignment Length:216 Identity:68/216 - (31%)
Similarity:121/216 - (56%) Gaps:33/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MST-YLQSSEGKFIPATKRPDGTWRKARRVKDGYVPQEEVPLYESKGKQFVAQRQAGVPPGMCPL 64
            |:| |:....||:|.||:||||:|||.|:||:|||||||||:||:|..:|...:.: :|||:...
 Frog     1 MATPYVTDESGKYIAATQRPDGSWRKQRKVKEGYVPQEEVPVYENKYVKFFKSKPS-LPPGLSET 64

  Fly    65 LAAESKKEREKQ---ERTRAKKQEKESGRQPKAPAPGVLVMPPSTCPPPKVSQQQQQQQQQPSGS 126
            .|:..|.::..:   :.|.:|..::...|:.|.                  .|::.:::|.....
 Frog    65 DASTGKTQQPSKPDADTTLSKTAKRNMKRKEKR------------------KQEKGEREQVEDAR 111

  Fly   127 RDINSIS-------KTLEDTLKLDAAQE---VVDPAKQLKKLRKKIREIEQIESRIQAGEQKKLD 181
            :|:..::       |.|....|..:|..   ..:.||::|.||||:|::|:::.:|.:||.|:..
 Frog   112 QDLERVNISETPVQKNLTSAHKNGSASSDNPAAERAKKIKNLRKKLRQVEELQQKIDSGEIKEPS 176

  Fly   182 KDQLDKVKKKSEILRQIKDLE 202
            |:||:|:.::..:..:|:|||
 Frog   177 KEQLEKLSRRKALEEEIEDLE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PymNP_726372.1 Mago-bind 11..35 CDD:286378 16/23 (70%)
pym1NP_001016274.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 16/28 (57%)
Mago-bind 12..36 CDD:370406 16/23 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..147 16/113 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11935
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I4678
OMA 1 1.010 - - QHG59719
OrthoDB 1 1.010 - - D1545729at2759
OrthoFinder 1 1.000 - - FOG0004103
OrthoInspector 1 1.000 - - otm48776
Panther 1 1.100 - - O PTHR22959
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3921
SonicParanoid 1 1.000 - - X3373
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.