DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pym and pym1

DIOPT Version :9

Sequence 1:NP_726372.1 Gene:Pym / 37780 FlyBaseID:FBgn0034918 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_956888.2 Gene:pym1 / 393566 ZFINID:ZDB-GENE-040426-1464 Length:194 Species:Danio rerio


Alignment Length:214 Identity:74/214 - (34%)
Similarity:120/214 - (56%) Gaps:33/214 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MST-YLQSSEGKFIPATKRPDGTWRKARRVKDGYVPQEEVPLYESKGKQFVAQRQAGVPPGMCPL 64
            |:| |:....||:|.||:||||:|||.|||:||||||||||:||:|..:|...:.. :|||:|..
Zfish     1 MATPYVTDESGKYIAATQRPDGSWRKPRRVRDGYVPQEEVPVYENKFVKFFKSKPE-LPPGVCVE 64

  Fly    65 LAAESKKE--------REKQERTRAKKQEKESGRQPKAPAPGVLVMPPSTCPPPKVSQQQQQQQQ 121
            ...:::.:        |..:...:.|::.::.|::.| |.| .|...|...|.|:.....||.||
Zfish    65 TPPQTQTQPSDAAGLSRTAKRNMKRKEKRRQQGQETK-PEP-ELQPEPELQPEPEPQGLSQQMQQ 127

  Fly   122 QPSGSRDINSISKTLEDTLKLDAAQ--EVVDPAKQLKKLRKKIREIEQIESRIQAGEQKKLDKDQ 184
                              |:|.|:|  ...|.|::||.||||:|::|:::.|:.:||.|. .::|
Zfish   128 ------------------LELSASQGPGAADSARRLKNLRKKLRQVEELQQRVLSGELKP-SQEQ 173

  Fly   185 LDKVKKKSEILRQIKDLES 203
            |||:.:...:..:::.||:
Zfish   174 LDKLGRAQALREELQQLEA 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PymNP_726372.1 Mago-bind 11..35 CDD:286378 17/23 (74%)
pym1NP_956888.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33 18/31 (58%)
Mago-bind 12..36 CDD:286378 17/23 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 54..140 22/106 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9621
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4780
OMA 1 1.010 - - QHG59719
OrthoDB 1 1.010 - - D1545729at2759
OrthoFinder 1 1.000 - - FOG0004103
OrthoInspector 1 1.000 - - oto40466
orthoMCL 1 0.900 - - OOG6_105546
Panther 1 1.100 - - LDO PTHR22959
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3921
SonicParanoid 1 1.000 - - X3373
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1313.010

Return to query results.
Submit another query.