DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pym and Pym1

DIOPT Version :9

Sequence 1:NP_726372.1 Gene:Pym / 37780 FlyBaseID:FBgn0034918 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_008763254.1 Gene:Pym1 / 366790 RGDID:1306096 Length:228 Species:Rattus norvegicus


Alignment Length:226 Identity:70/226 - (30%)
Similarity:117/226 - (51%) Gaps:51/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTYLQSSE--GKFIPATKRPDGTWRKARRVKDGYVPQEEVPLYESKGKQFVAQRQAGVPPGMCP 63
            |:|...:.|  ||:|.:|:||||||||.||||:|||||||||:||:|..:|...:.. :|||:.|
  Rat    27 MATPYVTDETGGKYIASTQRPDGTWRKQRRVKEGYVPQEEVPVYENKYVKFFKSKPE-LPPGLSP 90

  Fly    64 LLAAESKKEREKQERTRAKKQEKESGRQPKAPAPGVLVMPPSTCPPPKVSQQQQQQQQQPSGSRD 128
            ....:....|.........|..|.:                       :.::::::|||   .:|
  Rat    91 EATTQVTPSRPDSGEAGLSKTAKRN-----------------------LKRKEKRRQQQ---EKD 129

  Fly   129 INSISKTLEDTLKLDAAQ----------------------EVVDPAKQLKKLRKKIREIEQIESR 171
            ..::|:||:.....|:||                      ...:.||::|.||||:|::|:::.|
  Rat   130 AEALSRTLDKVSLGDSAQMPSAHHGPQATPPAASDAPDSAATTEKAKKIKNLRKKLRQVEELQQR 194

  Fly   172 IQAGEQKKLDKDQLDKVKKKSEILRQIKDLE 202
            |||||..:..::||:|:.::..:..:::|||
  Rat   195 IQAGEISQPSREQLEKLARRRVLEEELEDLE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PymNP_726372.1 Mago-bind 11..35 CDD:286378 17/23 (74%)
Pym1XP_008763254.1 Mago-bind 37..63 CDD:286378 18/25 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353317
Domainoid 1 1.000 69 1.000 Domainoid score I9388
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I4733
OMA 1 1.010 - - QHG59719
OrthoDB 1 1.010 - - D1545729at2759
OrthoFinder 1 1.000 - - FOG0004103
OrthoInspector 1 1.000 - - oto97511
orthoMCL 1 0.900 - - OOG6_105546
Panther 1 1.100 - - LDO PTHR22959
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3373
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.