Sequence 1: | NP_001286786.1 | Gene: | gbb / 37778 | FlyBaseID: | FBgn0024234 | Length: | 455 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004855.2 | Gene: | GDF15 / 9518 | HGNCID: | 30142 | Length: | 308 | Species: | Homo sapiens |
Alignment Length: | 245 | Identity: | 58/245 - (23%) |
---|---|---|---|
Similarity: | 92/245 - (37%) | Gaps: | 64/245 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 263 KDNHGIYIGAHAVNRPDREVKLDDIGLIHRKVDDEFQPFMIGFFRGPELIKATAHSSHHRSKRSA 327
Fly 328 S------HPRKRKKSVSPNNVPLLE---------------------------------------- 346
Fly 347 -------PMESTRSCQMQTLYIDFKDLGWHDWIIAPEGYGAFYCSGECNFPLNAHMNATNHAIVQ 404
Fly 405 TLVHLLEPKKVPKPCCAPTRLGALPVLYHLNDENVNLKKYRNMIVKSCGC 454 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
gbb | NP_001286786.1 | TGFb_propeptide | 44..305 | CDD:279078 | 10/41 (24%) |
TGFB | 354..455 | CDD:214556 | 35/101 (35%) | ||
GDF15 | NP_004855.2 | MscS_TM | <23..>147 | CDD:331130 | 18/79 (23%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 152..177 | 2/24 (8%) | |||
TGFB | 211..308 | CDD:214556 | 35/101 (35%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3900 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |