DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and GDF15

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_004855.2 Gene:GDF15 / 9518 HGNCID:30142 Length:308 Species:Homo sapiens


Alignment Length:245 Identity:58/245 - (23%)
Similarity:92/245 - (37%) Gaps:64/245 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 KDNHGIYIGAHAVNRPDREVKLDDIGLIHRKVDDEFQPFMIGFFRGPELIKATAHSSHHRSKRSA 327
            :|::...:.|.||.....||:|...|.:|.::.....|..:     ||  .:..|.:..|...:|
Human    74 EDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGL-----PE--ASRLHRALFRLSPTA 131

  Fly   328 S------HPRKRKKSVSPNNVPLLE---------------------------------------- 346
            |      .|.:|:.|::....|.|.                                        
Human   132 SRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRAR 196

  Fly   347 -------PMESTRSCQMQTLYIDFKDLGWHDWIIAPEGYGAFYCSGECNFPLNAHMNATNHAIVQ 404
                   |:...|.|::.|:....:||||.||:::|.......|.|.|.....|   |..||.::
Human   197 ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRA---ANMHAQIK 258

  Fly   405 TLVHLLEPKKVPKPCCAPTRLGALPVLYHLNDENVNLKKYRNMIVKSCGC 454
            |.:|.|:|..||.|||.|.....: ||....|..|:|:.|.:::.|.|.|
Human   259 TSLHRLKPDTVPAPCCVPASYNPM-VLIQKTDTGVSLQTYDDLLAKDCHC 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078 10/41 (24%)
TGFB 354..455 CDD:214556 35/101 (35%)
GDF15NP_004855.2 MscS_TM <23..>147 CDD:331130 18/79 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..177 2/24 (8%)
TGFB 211..308 CDD:214556 35/101 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.