DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and BMP15

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_005439.2 Gene:BMP15 / 9210 HGNCID:1068 Length:392 Species:Homo sapiens


Alignment Length:468 Identity:110/468 - (23%)
Similarity:173/468 - (36%) Gaps:127/468 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLMFVATTPPAVEATQSGIYIDNGKDQTIMHRVLSEDDKLDVSYEIL-EFLGIAERPTHLSSHQL 86
            |::|:.......|..||.|            .:|:|...|.:..|:| |..|...|...|..|.|
Human    15 LVLFMEHRAQMAEGGQSSI------------ALLAEAPTLPLIEELLEESPGEQPRKPRLLGHSL 67

  Fly    87 SLRKSAPKFLLDVYHRITAEEGLSDQDEDDDYERGHRSRRSADLEEDEGEQQKNFITDLDKRAID 151
                   :::|::|                        |||||   ..|..::|       |.|.
Human    68 -------RYMLELY------------------------RRSAD---SHGHPREN-------RTIG 91

  Fly   152 ESDIIMTFLNKRHHNVDELRHE---HGRRLWFDVSNVPNDN-YLVMAELRIYQNANEGKWLTANR 212
            .:   |..|.|...||.. .|.   |.:.|.|.:.  ||.. |.::....:|::..:   ||   
Human    92 AT---MVRLVKPLTNVAR-PHRGTWHIQILGFPLR--PNRGLYQLVRATVVYRHHLQ---LT--- 144

  Fly   213 EFTITVYAIGTGTLGQHTMEPLSSVNTTGDYV--------------GWLELNVTEGLHE--WLVK 261
            .|.::.:           :||....|.|..:.              .|.|:::|:.:.:  |..|
Human   145 RFNLSCH-----------VEPWVQKNPTNHFPSSEGDSSKPSLMSNAWKEMDITQLVQQRFWNNK 198

  Fly   262 -------------SKDNHGIYIGAHAVNRPDREVKLDDIGLIHRKV-DDEFQP-FMIGFFRGPEL 311
                         .||:.|:.:. |..:..|....|......|:.: ..:|.| .|..|.....|
Human   199 GHRILRLRFMCQQQKDSGGLELW-HGTSSLDIAFLLLYFNDTHKSIRKAKFLPRGMEEFMERESL 262

  Fly   312 IKATAHSSHHRSKRSASHPRKRKKSVSPNNVPLLEPMESTRSCQMQTLYIDFKDLGWHDWIIAPE 376
            ::.|..:....::.:||    ..|...|.|          ..|.:....|.|:.|||..|||||.
Human   263 LRRTRQADGISAEVTAS----SSKHSGPEN----------NQCSLHPFQISFRQLGWDHWIIAPP 313

  Fly   377 GYGAFYCSGECNFPLNAHMNATNHAIVQTLVHLLEPKKVPKPCCAPTRLGALPVLYHLNDENVNL 441
            .|...||.|.|...|...:|:.||||:|.|::.|..:.||:|.|.|.:...:.||....:.::..
Human   314 FYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILY 378

  Fly   442 KKYRNMIVKSCGC 454
            |:|..||.:||.|
Human   379 KEYEGMIAESCTC 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078 57/296 (19%)
TGFB 354..455 CDD:214556 39/101 (39%)
BMP15NP_005439.2 TGF_beta 291..391 CDD:306518 38/99 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.