DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and INHBE

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_113667.1 Gene:INHBE / 83729 HGNCID:24029 Length:350 Species:Homo sapiens


Alignment Length:372 Identity:98/372 - (26%)
Similarity:152/372 - (40%) Gaps:78/372 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 APKFLLDVYHRITAEEGLSDQDEDDDYERGHRSRRSADLEEDEGEQQKNFITDLDKRAIDESDII 156
            |.:.:||..| :|:...::.........|..|..:...:....||:..:|.|..|..:...|  :
Human    47 AKQQILDGLH-LTSRPRITHPPPQAALTRALRRLQPGSVAPGNGEEVISFATVTDSTSAYSS--L 108

  Fly   157 MTFLNKRHHNVDELRHEHGRRLWFDV-SNVPNDNYLVMAELRIY----QNANEG-KWLTANREFT 215
            :||    |.:.....|.:..|||..| ..:|.     ...|||:    :...:| :.|.|....|
Human   109 LTF----HLSTPRSHHLYHARLWLHVLPTLPG-----TLCLRIFRWGPRRRRQGSRTLLAEHHIT 164

  Fly   216 ITVYAIGTGTLGQHTMEPLSSVNTTGDYVGWLELNVTEGLHEWLVKSKDNHGIYIGAHAVNRPDR 280
                     .||.||: .|.|....|:..|.|:|.:            |...:...:....:|.|
Human   165 ---------NLGWHTL-TLPSSGLRGEKSGVLKLQL------------DCRPLEGNSTVTGQPRR 207

  Fly   281 EVKLDDIGLIHRKVDDEFQPFMIGFFRGPEL-IKATAHSSHHRSKRSASHPRKRKKSVSPNNVPL 344
              .||..|  |:      |||:       || |:|        ::..|...|:|        .|.
Human   208 --LLDTAG--HQ------QPFL-------ELKIRA--------NEPGAGRARRR--------TPT 239

  Fly   345 LEPMESTRSCQMQTLYIDFKDLGWHDWIIAPEGYGAFYCSGEC--NFPLNAHMNATNHAIVQTLV 407
            .||  :|..|..:..|:||::|||.|||:.||||...||||:|  :...:..:.|:.|:.|.:|:
Human   240 CEP--ATPLCCRRDHYVDFQELGWRDWILQPEGYQLNYCSGQCPPHLAGSPGIAASFHSAVFSLL 302

  Fly   408 HLLEPKKVPKPCCAPTRLGALPVLYHLNDENVNLKKYRNMIVKSCGC 454
            ....|......||.||....|.:||..::.||......:|:|::|||
Human   303 KANNPWPASTSCCVPTARRPLSLLYLDHNGNVVKTDVPDMVVEACGC 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078 49/218 (22%)
TGFB 354..455 CDD:214556 38/103 (37%)
INHBENP_113667.1 TGF_beta 247..349 CDD:306518 36/101 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.