DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and Inhbe

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_114003.2 Gene:Inhbe / 83711 RGDID:621196 Length:350 Species:Rattus norvegicus


Alignment Length:336 Identity:86/336 - (25%)
Similarity:131/336 - (38%) Gaps:89/336 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 GEQQK--NFITDLDKRAIDESDIIMTFLNKRHHNVDELRHEHGRRLWFDVSNVPNDNYLVMAELR 197
            |.::|  :|.|.:||.......::...|:.               ||        .::|..|.| 
  Rat    87 GNREKVISFATSIDKSTSTYRSVLTFQLSP---------------LW--------SHHLYHARL- 127

  Fly   198 IYQNANEGKWLTANREFTITVY--AIGTGTL---GQHTMEPLSSVNTTGDYVGWLELNVTEGLHE 257
                     ||.....|..|:|  ..|.||.   |..|.  |:...||..  ||           
  Rat   128 ---------WLHVPPSFPATLYLRIFGCGTTRCRGSRTF--LADYQTTSS--GW----------- 168

  Fly   258 WLVKSKDNHGIYIGAHAVNRPDREVKLDDIGLIHRKVDDEFQPFMIG--FFRGPELIKATAHSSH 320
                           ||:..|...::.::.|:  .|:..||:|..:.  ..|.|.|:..||....
  Rat   169 ---------------HALTLPSSGLRSEESGV--TKLQLEFRPLDLNSTTARLPRLLLDTAGQQR 216

  Fly   321 H--RSKRSASHP---RKRKKSVSPNNVPLLEPMESTRSCQMQTLYIDFKDLGWHDWIIAPEGYGA 380
            .  ..|..|:.|   |.|:::      |..|  ..|..|..:..|:||::|||.|||:.||||..
  Rat   217 PFLELKIRANEPGAGRARRRT------PTCE--SETPLCCRRDHYVDFQELGWRDWILQPEGYQL 273

  Fly   381 FYCSGEC--NFPLNAHMNATNHAIVQTLVHLLEPKKVPKPCCAPTRLGALPVLYHLNDENVNLKK 443
            .||||:|  :...:..:.|:.|:.|.:|:....|......||.||....|.:||..::.||....
  Rat   274 NYCSGQCPPHLAGSPGIAASFHSAVFSLLKANNPWPAGSSCCVPTARRPLSLLYLDHNGNVVKTD 338

  Fly   444 YRNMIVKSCGC 454
            ..:|:|::|||
  Rat   339 VPDMVVEACGC 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078 35/178 (20%)
TGFB 354..455 CDD:214556 38/103 (37%)
InhbeNP_114003.2 TGF_beta_INHBC_E 247..350 CDD:381676 38/103 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.