DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and Gdf9

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_067704.1 Gene:Gdf9 / 59304 RGDID:71038 Length:440 Species:Rattus norvegicus


Alignment Length:292 Identity:64/292 - (21%)
Similarity:111/292 - (38%) Gaps:60/292 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 TITVYAIGTGTLGQHTM---------EPLSSVNTT--GDYV------GWLELNVTEGLHEWLVKS 262
            ::.:|.:........|:         ||:||...|  ..|.      .|:|::||..|...:..|
  Rat   156 SVLLYTLNNSAASSSTVTCVCDLVVKEPMSSSKATPRAPYSFTLRKHRWIEMDVTSLLQPLVASS 220

  Fly   263 KDNHGIYIGAHAVNRPDREVKLDDIGLIHRKVDDEFQPFMIGF--------FRGPELIKATAHSS 319
            :  ..|::   :||......:..:.|..:..:  ...|.:|.:        :...:.:::|...|
  Rat   221 E--RSIHL---SVNFTCTRDQAPENGTFNMPL--SVPPSLILYLNDTSTQAYHSWQSLQSTQRHS 278

  Fly   320 HH----------------RSKRSASHPRKRKKSVSPNNVPLLEPMEST----------RSCQMQT 358
            .|                ..:||..|.|.:|...|....||......:          ..|::..
  Rat   279 QHPGQDSVTTRPVEEEATEVERSPRHRRGQKTLSSETKKPLTASFNLSEYFRQFLFPQNECELHD 343

  Fly   359 LYIDFKDLGWHDWIIAPEGYGAFYCSGECNFPLNAHMNATNHAIVQTLVH-LLEPKKVPKPCCAP 422
            ..:.|..|.|.:||:||..|...||.|:|...:.....:..|.:||.::: .|:| .||:|.|.|
  Rat   344 FRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVRHRYGSPVHTMVQNIIYEKLDP-SVPRPSCVP 407

  Fly   423 TRLGALPVLYHLNDENVNLKKYRNMIVKSCGC 454
            .:...|.||....|.::..|:|.:||...|.|
  Rat   408 GKYSPLSVLTIEPDGSIAYKEYEDMIATRCTC 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078 20/106 (19%)
TGFB 354..455 CDD:214556 33/102 (32%)
Gdf9NP_067704.1 TGF_beta 337..439 CDD:278448 32/102 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.