DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and tgfb5

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_021336789.1 Gene:tgfb5 / 559723 ZFINID:ZDB-GENE-130425-3 Length:414 Species:Danio rerio


Alignment Length:320 Identity:87/320 - (27%)
Similarity:134/320 - (41%) Gaps:76/320 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 RRLWFDVSNVP-NDNYLVMAELRIYQNANEGKWLTANREFTITVYAI---------GTGTLGQHT 230
            |.:.|||:||. |.:.||.||.||::..|.....|..|   :.:|.|         ....:...|
Zfish   129 RIVGFDVTNVERNSSTLVKAEFRIFRAPNPQARATEQR---VEIYQILKSEDVTAPSQRYIDSRT 190

  Fly   231 MEPLSSVNTTGDYVGWLELNVTEGLHEWLVKSKDNHGIYIGAHA------------VNRPDREVK 283
            :||.:.       ..||.::|||.:.||:...:.|.|:.|..|.            |.....|::
Zfish   191 VEPRAK-------GAWLSVDVTETVKEWMAFRERNLGLKISVHCPCCTFVPSTNNIVPNKSEELE 248

  Fly   284 LDDIGLIHRKVDDEF--QPFMIGFFRG--------PELI-------KATAHSSHHRSKRSASHPR 331
            ....|     :||:.  |....|..:|        |.||       :..:.....|.||||:   
Zfish   249 ARFAG-----IDDDLIKQTRKPGVTKGQIEFSTKTPHLILTLLPTDRLDSPIKKTRKKRSAA--- 305

  Fly   332 KRKKSVSPNNVPLLEPMESTRSCQMQTLYIDF-KDLGWHDWIIAPEGYGAFYCSGECNFPLNAHM 395
              ..|:...|         .:.|.:::||||| :||.| .||..|:||.|.:|:|.|.:    ..
Zfish   306 --DTSICTRN---------DQGCCLRSLYIDFRRDLNW-KWIHEPKGYKANFCAGNCPY----LW 354

  Fly   396 NATNH-AIVQTLVHLLEPKKVPKPCCAPTRLGALPVLYHLNDENVNLKKYRNMIVKSCGC 454
            :|.|| .::..|.:.:.|:....|||.|..|..|.::|.|. ....:::..||:|:||.|
Zfish   355 SADNHYNMILPLYNKMNPEASASPCCVPQDLEPLTIVYFLG-RTPRVEQLSNMVVRSCKC 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078 38/152 (25%)
TGFB 354..455 CDD:214556 37/103 (36%)
tgfb5XP_021336789.1 TGFb_propeptide 21..229 CDD:307025 32/109 (29%)
TGF_beta 317..413 CDD:306518 36/101 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.