DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and Gdf3

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001103141.1 Gene:Gdf3 / 500311 RGDID:1564178 Length:366 Species:Rattus norvegicus


Alignment Length:397 Identity:108/397 - (27%)
Similarity:177/397 - (44%) Gaps:67/397 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 YEILEFLGIAERPTHLSSHQLSLRKSAPKFLLDVYH-RITAEEGLSDQDEDDDYERGHRSRRSAD 129
            |:.|:|||:.:.|   |.|:.   :..|:.|..:.. |.||....:.||.....|.|.|. ....
  Rat    28 YDFLQFLGLKKAP---SPHRF---QPVPRILRKIIRARETAAASGASQDLCYVKELGVRG-NLLR 85

  Fly   130 LEEDEGEQQKNFITDLDKRAIDESDIIMTFLNKRHHNVDELRHEHGRRLWFDVSNVPNDNYLVMA 194
            |..|:|     |..:..|.:.|.|.:                   .:.|.|::|.|.....|.||
  Rat    86 LLPDQG-----FFLNTQKPSQDGSCL-------------------QKVLSFNLSAVKEKGKLTMA 126

  Fly   195 ELRIYQNANEGKWLTANREFTITVYAI-GTGTLGQHTMEP-----LSSVNTTGDYVGWLELNVTE 253
            :|.::.......:|  ..|..:.|..: ..|..|:  ..|     |...:..|.. |.|:.|:..
  Rat   127 QLILHLGPRSYHYL--QLELVVAVSVVQDRGVWGR--SHPKLGRLLVQKSVLGPQ-GSLQFNLQG 186

  Fly   254 GLHEWLVKSKDNHGIYIGAHAVNRPDREVKLDDIGLIHRKVDDEFQPFMIGFFRGPELIKATAHS 318
            .:.:|......|..:|:        :..||.|....::.::|:.....|....  ..|:..|.:.
  Rat   187 VVKDWNRHQLKNLDLYL--------EILVKEDRYSRVNAQLDNPCNQLMHSLH--ASLLVVTLNL 241

  Fly   319 SHHRSKRSASHPRKRKKSVSPNNVPLLEPMESTRS-CQMQTLYIDFKDLGWHDWIIAPEGYGAFY 382
            .|       .||..|||..:   :|:  |....|: |....|:::|:|||||.|:|||:|:.|.|
  Rat   242 KH-------CHPSSRKKRAA---IPI--PKGLCRNLCHRHQLFVNFQDLGWHKWVIAPKGFMANY 294

  Fly   383 CSGECNFPLNAHMNATNHAIVQTLVHLLEPKKVPKPCCAPTRLGALPVLYHLNDENVNLKKYRNM 447
            |.|:|.|.:..::|::|:|.:|.|:|:.:| :|||..|.||:|..:.:||..|::||.|:.|.:|
  Rat   295 CHGDCPFTMTTYLNSSNYAFMQALMHMADP-RVPKAVCIPTKLSPISMLYQDNEKNVILRHYEDM 358

  Fly   448 IVKSCGC 454
            :|..|||
  Rat   359 VVDECGC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078 52/245 (21%)
TGFB 354..455 CDD:214556 45/101 (45%)
Gdf3NP_001103141.1 TGFB 266..366 CDD:214556 45/101 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.