DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and INHBB

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_002184.2 Gene:INHBB / 3625 HGNCID:6067 Length:407 Species:Homo sapiens


Alignment Length:302 Identity:83/302 - (27%)
Similarity:125/302 - (41%) Gaps:77/302 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 RLWFDVSNVPNDN-YLVMAELRIYQN-----ANEGKWLTANREFTITVYAIGTGTLGQHTMEPLS 235
            ||:|.:||..|.| ::|.|.|.:|..     ..:|    :.|:..:.||....|...:..|    
Human   158 RLYFFISNEGNQNLFVVQASLWLYLKLLPYVLEKG----SRRKVRVKVYFQEQGHGDRWNM---- 214

  Fly   236 SVNTTGDY--VGWLELNVTEGLHEWLVKSKDNHGIYIGAHAVNRPDREVKLD-------DIGLIH 291
             |....|.  .||....:||.:..                ...|.:|.:.||       ::.::.
Human   215 -VEKRVDLKRSGWHTFPLTEAIQA----------------LFERGERRLNLDVQCDSCQELAVVP 262

  Fly   292 RKVD---DEFQPFMIGFFRGPELIKATAHSSHHRSKRSASHPRKRKKSVSPNNVPLLEPMESTRS 353
            ..||   :..:||::        ::|....|.||.       |||.          ||....|..
Human   263 VFVDPGEESHRPFVV--------VQARLGDSRHRI-------RKRG----------LECDGRTNL 302

  Fly   354 CQMQTLYIDFKDLGWHDWIIAPEGYGAFYCSGEC-----NFPLNAHMNATNHAIV-QTLVHLLEP 412
            |..|..:|||:.:||:||||||.||...||.|.|     ..|.:|  ::.:.|:| |..:..|.|
Human   303 CCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSA--SSFHTAVVNQYRMRGLNP 365

  Fly   413 KKVPKPCCAPTRLGALPVLYHLNDENVNLKKYRNMIVKSCGC 454
            ..| ..||.||:|..:.:||..::.|:..:...||||:.|||
Human   366 GTV-NSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGC 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078 31/145 (21%)
TGFB 354..455 CDD:214556 42/107 (39%)
INHBBNP_002184.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..62
TGFb_propeptide 57..278 CDD:279078 31/152 (20%)
TGFB 303..406 CDD:214556 40/105 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.