DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and INHA

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_002182.1 Gene:INHA / 3623 HGNCID:6065 Length:366 Species:Homo sapiens


Alignment Length:173 Identity:41/173 - (23%)
Similarity:67/173 - (38%) Gaps:32/173 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 EFQPFMIGFFRGPELIKATAHSSHHRSKRSASHPRKRKKSV------SPNNVPLLE--PME--ST 351
            |..||::               :|.|::..:...|.|:.:.      ||:.:.||:  |.|  :.
Human   210 EATPFLV---------------AHTRTRPPSGGERARRSTPLMSWPWSPSALRLLQRPPEEPAAH 259

  Fly   352 RSCQMQTLYIDFKDLGWHDWIIAPEGYGAFYCSGEC--NFPLNAHMNATNHAIVQTLVHLLEPKK 414
            .:|....|.|.|::|||..||:.|..:...||.|.|  :.|.|..:............:.|.|. 
Human   260 ANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPG- 323

  Fly   415 VPKPCCAPTRLGALPVLYHLNDENVNLKKYR---NMIVKSCGC 454
             .:||||.......|:......:.....||.   |::.:.|.|
Human   324 -AQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCAC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078 3/7 (43%)
TGFB 354..455 CDD:214556 28/106 (26%)
INHANP_002182.1 TGFB 262..366 CDD:214556 28/106 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.