DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and Gdf1

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001037705.1 Gene:Gdf1 / 306351 RGDID:1304678 Length:357 Species:Rattus norvegicus


Alignment Length:192 Identity:59/192 - (30%)
Similarity:87/192 - (45%) Gaps:45/192 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 GPELIK-----------------ATAHSSHHRSKR--SASHP-------RKRKKS-----VSPNN 341
            ||||::                 ..|::|..|:.|  .|.||       |..:.|     :.|..
  Rat   165 GPELLRVQAPPGLPLRADLLGTAVAANASVPRTLRLALALHPGAAATCGRLAEASLLLVTLDPRL 229

  Fly   342 VPLLEPMESTR---------SCQMQTLYIDFKDLGWHDWIIAPEGYGAFYCSGECNFPLNAH--- 394
            .||......|.         :|:.:.|::.|:::|||.|:|||.|:.|.:|.|.|..|....   
  Rat   230 CPLPRSRRHTEPRVGGGPVGTCRTRRLHVSFREVGWHRWVIAPRGFLANFCQGTCALPETLRGPG 294

  Fly   395 -MNATNHAIVQTLVHLLEPKK-VPKPCCAPTRLGALPVLYHLNDENVNLKKYRNMIVKSCGC 454
             ..|.|||:::.|:|...|.. |..|||.|.||..:.||:..|.:||.|:.|.:|:|..|||
  Rat   295 GPPALNHAVLRALMHAAAPTPGVGSPCCVPERLSPISVLFFDNSDNVVLRHYEDMVVDECGC 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078
TGFB 354..455 CDD:214556 42/106 (40%)
Gdf1NP_001037705.1 TGFB 251..357 CDD:214556 42/106 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.