DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and ndr2

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_624359.1 Gene:ndr2 / 30292 ZFINID:ZDB-GENE-990415-181 Length:501 Species:Danio rerio


Alignment Length:172 Identity:57/172 - (33%)
Similarity:88/172 - (51%) Gaps:19/172 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 DDIGLIHRKVDDEFQPFMIGFFRGPELIKATAHSSHHRSKRSASHPRKRKKSVSPNNVPLLE--P 347
            |...|:|.....:|.     |.|..:.:|      ..|:.||     :|.:...|...|.|:  |
Zfish   346 DGASLLHTAGASKFL-----FSRNKKEVK------RGRALRS-----RRGRRGPPVRSPELQRTP 394

  Fly   348 MESTRSCQMQTLYIDFKDLGWHDWIIAPEGYGAFYCSGECNFPLNAHMNATNHAIVQTLVHLLEP 412
            :..:.:|:...:::||..:||..||:.|:.|.|:.|.|.|..||...:..||||.:|:|:....|
Zfish   395 LHKSTTCRRVDMHVDFNQIGWGSWIVFPKKYNAYRCEGACPNPLGEELRPTNHAYMQSLLKYHHP 459

  Fly   413 KKVPKPCCAPTRLGALPVLYHLNDENVNLKKYRNMIVKSCGC 454
            .:||..||||||..||.:||:.|.|.: |:.:.:|.|:.|||
Zfish   460 SRVPASCCAPTRTSALSMLYYENGEMI-LRHHEDMQVEECGC 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078 4/19 (21%)
TGFB 354..455 CDD:214556 42/101 (42%)
ndr2NP_624359.1 TGFb_propeptide 44..>174 CDD:279078
DUF1631 <175..>277 CDD:285086
TGF_beta 401..500 CDD:278448 40/99 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.