DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and gdf3

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_571023.1 Gene:gdf3 / 30125 ZFINID:ZDB-GENE-980526-389 Length:355 Species:Danio rerio


Alignment Length:418 Identity:119/418 - (28%)
Similarity:185/418 - (44%) Gaps:102/418 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SEDDKLDVSYEILEFLGIAERPTHLSSHQLSLRKSAPKFLLDVYHRITAEEGLSDQDEDDDY-ER 120
            :|||.|......|..:|:..||.  .||..::    |..:..::.: .:::.::|.....:| .|
Zfish    19 AEDDGLVQEKLFLSSMGLWSRPK--PSHHAAV----PSQMWKIFKQ-ASKQTVNDPCVVSEYGVR 76

  Fly   121 GHRSRRSADLEEDEGEQQKNFITDLDKRAIDESDIIMTFLNKRHHNVDELRHEHGRRLWFDVSNV 185
            |:..|    ..:|:|             ::..:..:.:|...|.|            |:|::|.:
Zfish    77 GNIVR----FMQDQG-------------SLISAPAVHSFNCVRKH------------LFFNMSVL 112

  Fly   186 PNDNYLVMAELRIYQNANEGKWLTANREFTITVYAIGTGTLGQHTMEP-----LSSVNTTGDYVG 245
            .....|.:|:|.:  ...:...|.....|::.:|.:...||...|.|.     .|...:.|.:..
Zfish   113 EEVEQLSLAQLEM--KFKQDLLLLGPHVFSVDLYRVLKTTLKGVTHESSRKLLQSQTLSPGAHAS 175

  Fly   246 WLELNVTEGLHEWLVKSKDNHGIYIGA-----------HA-VNRPDREVKLDDIGLIHRKVDDEF 298
            .| :|:|.....|. |.:.|.|:.:..           || |..||          ||..:    
Zfish   176 VL-VNLTNLAQSWR-KPEKNFGMQLELQVMHLNNMLHDHAYVQIPD----------IHATL---- 224

  Fly   299 QPFMIGFFRGPELIKATAHSSHHRSKRSASH--PRKRKKSVSPNNVPLLEPMESTRSCQMQTLYI 361
                       .::.........|.|||||:  |      |:|:||           |:.:.|||
Zfish   225 -----------VVVSLNPLQCRSRRKRSASYYLP------VTPSNV-----------CKPRRLYI 261

  Fly   362 DFKDLGWHDWIIAPEGYGAFYCSGECNFPLNAHMNATNHAIVQTLVHLLEPKKVPKPCCAPTRLG 426
            ||||:||.||||||:||.|.||.|||.|||:..:|.|||||:|||||..:||..|:|||.|.:|.
Zfish   262 DFKDVGWQDWIIAPQGYLANYCHGECPFPLSESLNGTNHAILQTLVHSFDPKGTPQPCCVPIKLS 326

  Fly   427 ALPVLYHLNDENVNLKKYRNMIVKSCGC 454
            .:.:||:.|::||.|:.|.:|:|..|||
Zfish   327 PISMLYYDNNDNVVLRHYEDMVVDECGC 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078 50/265 (19%)
TGFB 354..455 CDD:214556 58/101 (57%)
gdf3NP_571023.1 TGFb_propeptide 27..200 CDD:279078 39/212 (18%)
TGFB 254..355 CDD:214556 58/101 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.