DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and GDF1

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001374367.1 Gene:GDF1 / 2657 HGNCID:4214 Length:372 Species:Homo sapiens


Alignment Length:125 Identity:46/125 - (36%)
Similarity:69/125 - (55%) Gaps:13/125 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 PLLEPMESTR---------SCQMQTLYIDFKDLGWHDWIIAPEGYGAFYCSGECNFPL----NAH 394
            ||..|.....         :|:.:.||:.|:::|||.|:|||.|:.|.||.|:|..|:    :..
Human   247 PLARPRRDAEPVLGGGPGGACRARRLYVSFREVGWHRWVIAPRGFLANYCQGQCALPVALSGSGG 311

  Fly   395 MNATNHAIVQTLVHLLEPKKVPKPCCAPTRLGALPVLYHLNDENVNLKKYRNMIVKSCGC 454
            ..|.|||:::.|:|...|.....|||.|.||..:.||:..|.:||.|::|.:|:|..|||
Human   312 PPALNHAVLRALMHAAAPGAADLPCCVPARLSPISVLFFDNSDNVVLRQYEDMVVDECGC 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078
TGFB 354..455 CDD:214556 43/105 (41%)
GDF1NP_001374367.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..86
TGF_beta_GDF1_3_like 267..372 CDD:381642 43/105 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.