DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and Amh

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_037034.1 Gene:Amh / 25378 RGDID:2108 Length:553 Species:Rattus norvegicus


Alignment Length:103 Identity:28/103 - (27%)
Similarity:46/103 - (44%) Gaps:7/103 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 CQMQTLYIDFKDLGWHDWIIAPEGYGAFYCSGECNFP-LNAHMNATNHAIVQTLVHLLEPKKVPK 417
            |.::.|.:|.:.   ...::.||.|.|..|.|.|.:| .:.:....||.::...:..........
  Rat   455 CALRELSVDLRA---ERSVLIPETYQANNCQGACAWPQSDRNPRYGNHVVLLLKMQARGAALGRL 516

  Fly   418 PCCAPTR-LGALPVLYHLNDENVNLKKYRNMIVKSCGC 454
            |||.||. .|.|  |..|::|:::.....||:...|||
  Rat   517 PCCVPTAYTGKL--LISLSEEHISAHHVPNMVATECGC 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078
TGFB 354..455 CDD:214556 28/103 (27%)
AmhNP_037034.1 AMH_N 74..417 CDD:282552
TGFB 455..553 CDD:214556 28/103 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.