DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and Gdf7

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_006239940.1 Gene:Gdf7 / 252833 RGDID:620105 Length:456 Species:Rattus norvegicus


Alignment Length:373 Identity:88/373 - (23%)
Similarity:142/373 - (38%) Gaps:126/373 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 DELRHEHGRRLWFDVSNVPNDNYLVMAELRIYQNANEGKWLTANREFTITVYAIGTGTLGQHTME 232
            :|...|.|:...||||::.:.:.:|.||||:.:..:.    ..:|:              ..|:.
  Rat   123 EESAAEPGQSFLFDVSSLSDSDEVVNAELRVLRRRSP----EPDRD--------------SATLP 169

  Fly   233 PLSSVNTTGDYVG-----------------WLELNVTEGLHEWLVKSKDNHGIYIGAHAVNRPDR 280
            ||..::|..|..|                 |...:||:.:.......:.:....:...||...:.
  Rat   170 PLLLLSTCPDEAGTAHLLHSRAAEPLDSARWEAFDVTDAVQSHRRWPRTSRKFCLVLRAVTGAES 234

  Fly   281 E-VKLDDIGL------------------------IHRKVDDEFQPFMIGFFRGPELIKATAHSSH 320
            . :.|..:|.                        .|||.         ..||.   |:|.|.:..
  Rat   235 SPLALRRLGFGWPGGGDGGGTAAEERALLVISSRTHRKE---------SLFRE---IRAQARALR 287

  Fly   321 HR------------SKRSASHPRKRKKSVSPNNVPLLEPMESTRS-------------------- 353
            ..            |:::....|:|:::.          :..||.                    
  Rat   288 AAAELPPDPGLGAGSRKATPGGRRRRRTA----------LAGTRGAQGSGGGGGGGGGGGGGGGG 342

  Fly   354 ------------CQMQTLYIDFKDLGWHDWIIAPEGYGAFYCSGECNFPLNAHMNATNHAIVQTL 406
                        |..:.|::|||:|||.||||||..|.|::|.|.|:|||.:|:..|||||:|||
  Rat   343 AGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGVCDFPLRSHLEPTNHAIIQTL 407

  Fly   407 VHLLEPKKVPKPCCAPTRLGALPVLYHLNDENVNLKKYRNMIVKSCGC 454
            ::.:.|...|..||.|.||..:.:||.....||..|:|.:|:|::|||
  Rat   408 LNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGC 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078 29/178 (16%)
TGFB 354..455 CDD:214556 49/101 (49%)
Gdf7XP_006239940.1 TGFb_propeptide <87..230 CDD:279078 23/124 (19%)
TGF_beta 358..455 CDD:278448 46/96 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.