DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and Tgfb2

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_001316036.1 Gene:Tgfb2 / 21808 MGIID:98726 Length:442 Species:Mus musculus


Alignment Length:316 Identity:87/316 - (27%)
Similarity:133/316 - (42%) Gaps:75/316 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 FDVSNV-PNDNYLVMAELRIYQNANEGKWLTANREFTITVYAI-GTGTLGQHTMEPLSS--VNTT 240
            ||||.: .|.:.||.||.|:::..|....:...|   |.:|.| .:..|...|...:.|  |.|.
Mouse   160 FDVSTMEKNASNLVKAEFRVFRLQNPKARVAEQR---IELYQILKSKDLTSPTQRYIDSKVVKTR 221

  Fly   241 GDYVG-WLELNVTEGLHEWLVKSKDNHGIYIGAHA------------VNRPDREVKLDDIGLIHR 292
            .:  | ||..:||:.:.|||.....|.|..|..|.            :.....|::....|:   
Mouse   222 AE--GEWLSFDVTDAVQEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGI--- 281

  Fly   293 KVDDEFQPFMIGFFRGPELIKATAHSSHHRSKRSASHPRKRKKSVSPNNVPLLEP---MESTRS- 353
               |....:..|   ..:.||:|               ||:....:|:.:.:|.|   :||.:| 
Mouse   282 ---DGTSTYASG---DQKTIKST---------------RKKTSGKTPHLLLMLLPSYRLESQQSS 325

  Fly   354 -------------------CQMQTLYIDFK-DLGWHDWIIAPEGYGAFYCSGECNFPLNAHMNAT 398
                               |.::.|||||| |||| .||..|:||.|.:|:|.|.:..::.   |
Mouse   326 RRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW-KWIHEPKGYNANFCAGACPYLWSSD---T 386

  Fly   399 NHAIVQTLVHLLEPKKVPKPCCAPTRLGALPVLYHLNDENVNLKKYRNMIVKSCGC 454
            .|..|.:|.:.:.|:....|||....|..|.:||::.: ...:::..|||||||.|
Mouse   387 QHTKVLSLYNTINPEASASPCCVSQDLEPLTILYYIGN-TPKIEQLSNMIVKSCKC 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078 35/141 (25%)
TGFB 354..455 CDD:214556 40/102 (39%)
Tgfb2NP_001316036.1 TGFb_propeptide 21..256 CDD:279078 32/100 (32%)
TGF_beta 344..441 CDD:278448 39/101 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.