DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and Nodal

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_038639.2 Gene:Nodal / 18119 MGIID:97359 Length:354 Species:Mus musculus


Alignment Length:358 Identity:85/358 - (23%)
Similarity:136/358 - (37%) Gaps:115/358 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 RAIDESDIIMTFLNKRHHNVDELRHEHGRRLW---FDVSNVPNDNYLVMAELRI-----YQNANE 204
            |::...|:.:|..|                 |   ||.|.:..:..||.||||:     .....|
Mouse    60 RSLQAQDVDVTGQN-----------------WTFTFDFSFLSQEEDLVWAELRLQLPGPMDIPTE 107

  Fly   205 GKWLTANREFTITVYAIGTGTLGQHTMEPLSSVNTTGDYVGWLE-----------------LNVT 252
            |       ..||.::....|...:...:.|..:        |:|                 |.||
Mouse   108 G-------PLTIDIFHQAKGDPERDPADCLERI--------WMETFTVIPSQVTFASGSTVLEVT 157

  Fly   253 EGLHEWL---------VKSKDN---HGIYIGAHAV----------NRPDREVKLDDIGLIHRKVD 295
            :.|.:||         |.|:..   |..|.....|          |||..:.:|....|:..   
Mouse   158 KPLSKWLKDPRALEKQVSSRAEKCWHQPYTPPVPVASTNVLMLYSNRPQEQRQLGGATLLWE--- 219

  Fly   296 DEFQPFMIGFFRGPELIKATAHSSHHRSKRSASHPR----KRKKSVSPNNVPLLEPMESTRSCQM 356
                                |.||....:...|..|    :|::.   :::|     :.::.|:.
Mouse   220 --------------------AESSWRAQEGQLSVERGGWGRRQRR---HHLP-----DRSQLCRR 256

  Fly   357 QTLYIDFKDLGWHDWIIAPEGYGAFYCSGECNFPLNAHMNATNHAIVQTLVHLLEPKKVPKPCCA 421
            ....:||..:||..|||.|:.|.|:.|.|||..|:....:.||||.:|:|:...:|.:||..|||
Mouse   257 VKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCA 321

  Fly   422 PTRLGALPVLYHLNDENVNLKKYRNMIVKSCGC 454
            |.:...|.:|| :::..|.|:.:::|||:.|||
Mouse   322 PVKTKPLSMLY-VDNGRVLLEHHKDMIVEECGC 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078 38/203 (19%)
TGFB 354..455 CDD:214556 40/101 (40%)
NodalNP_038639.2 TGFb_propeptide 33..169 CDD:279078 28/140 (20%)
TGFB 254..353 CDD:214556 38/99 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.