DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and Inhbb

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_032407.1 Gene:Inhbb / 16324 MGIID:96571 Length:411 Species:Mus musculus


Alignment Length:301 Identity:82/301 - (27%)
Similarity:128/301 - (42%) Gaps:75/301 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 RLWFDVSNVPNDN-YLVMAELRIYQN-----ANEGKWLTANREFTITVYAIGTGTLGQ-HTMEPL 234
            ||:|.|||..|.| ::|.|.|.:|..     ..:|    :.|:..:.||....|...: :.:|..
Mouse   162 RLYFFVSNEGNQNLFVVQASLWLYLKLLPYVLEKG----SRRKVRVKVYFQEQGHGDRWNVVEKK 222

  Fly   235 SSVNTTGDYVGWLELNVTEGLHEWLVKSKDNHGIYIGAHAVNRPDREVKLD-------DIGLIHR 292
            ..:..:    ||....:||.:..                ...|.:|.:.||       ::.::..
Mouse   223 VDLKRS----GWHTFPITEAIQA----------------LFERGERRLNLDVQCDSCQELAVVPV 267

  Fly   293 KVD---DEFQPFMIGFFRGPELIKATAHSSHHRSKRSASHPRKRKKSVSPNNVPLLEPMESTRSC 354
            .||   :..:||::        ::|....|.||.       |||.          ||....|..|
Mouse   268 FVDPGEESHRPFVV--------V
QARLGDSRHRI-------RKRG----------LECDGRTSLC 307

  Fly   355 QMQTLYIDFKDLGWHDWIIAPEGYGAFYCSGEC-----NFPLNAHMNATNHAIV-QTLVHLLEPK 413
            ..|..:|||:.:||:||||||.||...||.|.|     ..|.:|  ::.:.|:| |..:..|.|.
Mouse   308 CRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSA--SSFHTAVVNQYRMRGLNPG 370

  Fly   414 KVPKPCCAPTRLGALPVLYHLNDENVNLKKYRNMIVKSCGC 454
            .| ..||.||:|.::.:||..::.|:..:...||||:.|||
Mouse   371 PV-NSCCIPTKLSSMSMLYFDDEYNIVKRDVPNMIVEECGC 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078 30/144 (21%)
TGFB 354..455 CDD:214556 42/107 (39%)
InhbbNP_032407.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..69
TGFb_propeptide 73..282 CDD:307025 30/151 (20%)
TGFB 307..410 CDD:214556 40/105 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.