DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gbb and Gdf5

DIOPT Version :9

Sequence 1:NP_001286786.1 Gene:gbb / 37778 FlyBaseID:FBgn0024234 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_032135.2 Gene:Gdf5 / 14563 MGIID:95688 Length:495 Species:Mus musculus


Alignment Length:405 Identity:110/405 - (27%)
Similarity:173/405 - (42%) Gaps:94/405 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 RPTHLSSHQLSLRKSAPKFLLDVYHRITAEEGLSDQDEDDDYERGHRSRRSADLEEDEGEQQKNF 141
            ||..::.|:         ::|.:|..      |||.|     .:|..|  |..||........:|
Mouse   157 RPPPITPHE---------YMLSLYRT------LSDAD-----RKGGNS--SVKLEAGLANTITSF 199

  Fly   142 ITDLDKRAIDESDIIMTFLNKRHHNVDELRHEHGRRLWFDVSNVPNDNYLVMAELRIYQNANEGK 206
            |   ||...|....:                 ..:|..||:|.:..|. |:.|||||.       
Mouse   200 I---DKGQDDRGPAV-----------------RKQRYVFDISALEKDG-LLGAELRIL------- 236

  Fly   207 WLTANREFTITVYAIGTGTLGQHTMEPLSSVNTTGDYVGWLELNVTEGL--HEWLV--------K 261
                 |:..:.|......:.|:.....|||..:.......|::....||  ..|.|        .
Mouse   237 -----RKKPLDVAKPAVPSSGRVAQLKLSSCPSGRQPAALLDVRSVPGLDGSGWEVFDIWKLFRN 296

  Fly   262 SKDNHGIYIGAHAVNRPDREVKLDDIGL--IHRKVDDEFQPFMIGFFRGPEL----IKATAHS-- 318
            .|::..:.:...|..| .|.|.|..:|.  ..|:|.::....:.|..:..:|    |||.:..  
Mouse   297 FKNSAQLCLELEAWER-GRAVDLRGLGFERTARQVHEKALFLVFGRTKKRDLFFNEIKARSGQDD 360

  Fly   319 --------SHHRSKRSASHPRKRKKSVSPNNVPLLEPMESTRS-CQMQTLYIDFKDLGWHDWIIA 374
                    |..|.:|:....|:.|:           |.::.:: |..:.|:::|||:||.|||||
Mouse   361 KTVYEYLFSQRRKRRAPLANRQGKR-----------PSKNLKARCSRKALHVNFKDMGWDDWIIA 414

  Fly   375 PEGYGAFYCSGECNFPLNAHMNATNHAIVQTLVHLLEPKKVPKPCCAPTRLGALPVLYHLNDENV 439
            |..|.||:|.|.|.|||.:|:..||||::|||::.::|:..|..||.||||..:.:|:..:..||
Mouse   415 PLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNV 479

  Fly   440 NLKKYRNMIVKSCGC 454
            ..|:|.:|:|:||||
Mouse   480 VYKQYEDMVVESCGC 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gbbNP_001286786.1 TGFb_propeptide 44..305 CDD:279078 50/239 (21%)
TGFB 354..455 CDD:214556 49/101 (49%)
Gdf5NP_032135.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..162 2/4 (50%)
TGFb_propeptide 139..338 CDD:279078 50/236 (21%)
TGFB 394..495 CDD:214556 49/101 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.